Cytotoxic lymphocyte maturation factor 40 kDa subunit Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine- activated killer cells, and stimulate the production of IFN-gamma by resting PBMC (By similarity). IL-12 subunit p40 329 Associates with IL23A to form the IL-23 interleukin, an heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to an heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak- Stat signaling cascade, stimulates memory rather than naive T- cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis (By similarity). MCHQWLVLSWFSLVLLASPLMAIWELEKDVYVVELDWYPDAPGEMVVLTCNTPEEEGITWTSAQSNEVLGSGKTLTIQVKEFGDAGWYTCHKGGEVLSHSHLLLHKKEDGIWSTDILKDQKESKNKTFLKCEAKNYSGRFTCWWLTAISTDLKFSVKSSRGSSDPRGVTCGAATLSAERVSVDDREYKKYTVECQEGSACPAAEESLPIEIVVDAVHKLKYENYTSGFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPETWSTPHSYFSLTFSIQVQGKNKKERKDRLFMDETSATVTCHKDGQIRVQARDRYYSSSWSEWASVSCS IL12B Interleukin-12 subunit beta IL12B_HORSE